PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G132000.1
Common NameB456_008G132000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 740aa    MW: 80501.1 Da    PI: 6.5853
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G132000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Gorai.008G132000.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.0E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-82464IPR009057Homeodomain-like
PfamPF002493.0E-132467IPR001005SANT/Myb domain
CDDcd001671.41E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MDTYSSGEEL VTKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALAKG VPIGQALDIE IPPPRPKRKP NNPYPRKTGA ATTIQDGAKD  120
GKSETPISSS RCKQVLDLEK EPLPERPNGD EKSTNLKENQ DESCSGVFTL LHEANCSSAS  180
SMNKNFIPAS AALKSSCTFR EFVPSPKEVK IHDNGTSKAS NLEYSCTSYD KPAQVQRKDD  240
LDGALCADEM QAAQNYPRHV SVHVLDGSLR TCAQNPSLDM SFQDSVFHPM GDVHGPNLSA  300
NLAASAATEH QNNALRSTQQ ALPPFHTPFM HLRPNQQDYR SFLHVSSTFS SLIVSTLLQN  360
PAAHAAASFA ARFWPYANIE SSGDSPACGL GGFPSRQINS APSMAAIAAA TVAAATAWWA  420
AHGLFPVCAP LHTGFTCFPA STAAVPPMEN GQPPAAKTEQ KGKTDQALSL QVEQLDPENS  480
EALQGQHSSS KSPTSSSSDC EERGDAKVNT GVKATDDEMA AEVIEPQDAN KTKNKKQVDR  540
SSCGSNTPSS SEVETDALEK HEKDKEDSKG ADPNHPQVEC SRRSSRSNSN LSDSWKEVSE  600
EGRLAFQALF SREVLPQSFS PPHDGKSKGQ QKENIGEDKQ NPAEEDEEIS TLDLNSKTLG  660
SCSDHQVTVK NALSRDKNTT EEGLLTIGLG HSKLKAGRTG FKPYKRCSVE AKENRVMNTG  720
SQGEEKGPKR VRLEGEAST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437835.10.0PREDICTED: protein LHY-like isoform X2
SwissprotQ6R0H11e-160LHY_ARATH; Protein LHY
TrEMBLA0A0D2T5D40.0A0A0D2T5D4_G
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-146MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]